PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G107900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 826aa    MW: 89641.1 Da    PI: 6.9106
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G107900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-095976341954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Aqcoe6G107900.2.p 597 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 634
                        664459******************************88 PP

2BELL124.73.7e-40457528172
               BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        +r ++q+kk+kLls+l+eVd+rY++y+eq+q+v++sF+ v+g gsa+pYt+lA+ka+SrhFrcLkdai+ q+
  Aqcoe6G107900.2.p 457 DRIDHQRKKTKLLSMLDEVDRRYNHYCEQMQVVVNSFDSVMGFGSATPYTALAQKAMSRHFRCLKDAITTQL 528
                        5789*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-79383526IPR006563POX domain
PfamPF075262.1E-52389525IPR006563POX domain
PROSITE profilePS5007112.568575638IPR001356Homeobox domain
CDDcd000862.83E-12578639No hitNo description
SMARTSM003891.2E-9578642IPR001356Homeobox domain
SuperFamilySSF466893.98E-17580645IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28581644IPR009057Homeodomain-like
PfamPF059204.2E-18595634IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    Send to blast
MRATTLPPPL FILNTQKSTN SVVKSMSKGF NHQGINISFS SNEFQDHQLQ QQQQSHITQQ  60
GRRDKLRVQA AGGFDAPPAS LVAIEPEEEE VPGGGGMAPV YETSGMWSDM FNYQSGGTTS  120
TSTEFLENQI SSSNYHRLHH REAAVAPPVG VVANEWYGNR QGMVGGFGMG PLGDSKQQTN  180
NSDNRDSNII AQNHQISSLN ADSAAAMQLF LMNPQPRSPS PSPTTTSSTP LHLLLPNQQQ  240
SSSHHSNLQQ HFHNSAAAAF ANSPASQFQW VSSSSSSGVG NNTAAQTQLN KIGTAIENQG  300
LSLTLSTSLQ HLEAAKAEEF RMGEDGVFYY DQGSGIGGGS GSSSSASVAF QLKNYIPHNQ  360
AIHLQGIVNQ NQMMNTAGLR SPIGVMSLLR NSKYSKAAQE LLEEFCSVGR GHLKKHRSLA  420
RNNSINQAST ASFGGGGGGG NGSSSSSKEL TSLSAADRID HQRKKTKLLS MLDEVDRRYN  480
HYCEQMQVVV NSFDSVMGFG SATPYTALAQ KAMSRHFRCL KDAITTQLKQ TCELLGEKDS  540
AGVSGVTKGE TPRLKLLEQS LRQQRAFHQM GMMEQEAWRP QRGLPERSVN ILRAWLFEHF  600
LHPYPSDADK HLLARQTGLS RNQVSNWFIN ARVRLWKPMV EEMYQQEAKE EDADEDERES  660
NQTNSNTAQT PMPTTAATTT TTQPVSTAAT IPTTTSSATT TVAGKRSQIN DLDNDPSLNA  720
INTQCFSENQ VMQANLTTTT TTTTSHADVS SYGTLHSDVS HFDPSCHVSS IIADDYRTTS  780
GNAEMASTLV RFGTTMGDVS LTLGLRHAGN LPEKNNFSVR DFGGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16584642563Homeobox protein Meis2
3k2a_B1e-16584642563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4066991e-111AF406699.1 Solanum tuberosum BEL1-related homeotic protein 13 (Bel13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254984.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-156BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLB9HEL70.0B9HEL7_POPTR; Uncharacterized protein
STRINGPOPTR_0007s12170.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-138BEL1-like homeodomain 4